KEGG   Paracoccus methylovorus: JWJ88_19430
Entry
JWJ88_19430       CDS       T08684                                 
Name
(GenBank) thiamine pyrophosphate-binding protein
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
pmeh  Paracoccus methylovorus
Pathway
pmeh00290  Valine, leucine and isoleucine biosynthesis
pmeh00650  Butanoate metabolism
pmeh00660  C5-Branched dibasic acid metabolism
pmeh00770  Pantothenate and CoA biosynthesis
pmeh01100  Metabolic pathways
pmeh01110  Biosynthesis of secondary metabolites
pmeh01210  2-Oxocarboxylic acid metabolism
pmeh01230  Biosynthesis of amino acids
Module
pmeh_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
pmeh_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:pmeh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    JWJ88_19430
   00660 C5-Branched dibasic acid metabolism
    JWJ88_19430
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    JWJ88_19430
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    JWJ88_19430
Enzymes [BR:pmeh01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     JWJ88_19430
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N TPP_enzyme_M
Other DBs
NCBI-ProteinID: QRZ15113
UniProt: A0ABX7JLI3
LinkDB
Position
2:1286797..1288491
AA seq 564 aa
MRKGAEILADELALNGAQIVYHVPGESFLLALDALATRHPEIRAISCRHENGAAQMAEAH
GKLTGQPGVAFVTRSPGATNAVNGVHTAFQDSSPMILIVGQVKRAILEREAFMAYDFRTM
FAPMAKWVAQIDDPARIPEFVQRAWATALSGRRGPVVLVVPEDVLEEYCDVAPSIRPASA
SHAGAPRQQDLERIFGMLGEAERPLVVVGGSDWSETAREDIQSFATRLGLPVVTTFRRRD
IIDHRLDCYAGEIGIGSNPALLAHIKEADFVLMLNDALSDVNTIGAGYMEGFTLFSIPHP
KQKIVHVMADHADLNRVFQVDLALVADNDATAGALAGHDARPVPTHAEWTAKLRATLLAE
REPQPCPGAIDLPGVMGWLRERLPEDAIVTNGVGAYATWSQRYFPHYRLHTQLGPISGSM
GYSLPAAIAAKLAYSERVVVDFVGDGCFQMSSEELATAVQYGANIVILLFNNGLYGTIRI
HEENRLNGRVNGTDLTNPDFLLLAQAYGAHGERVTTTEEFAPAFERALAAGKPALIEMII
DPEAIHCRYSLSDLRARRAARAPD
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgagaaaaggtgcagaaatccttgccgacgaactggcgctgaacggtgcgcagattgtc
tatcacgtgccgggcgagagttttcttcttgcgctcgacgccttggcgacgcgacacccc
gagatccgcgcgatcagttgccggcatgaaaacggcgcggcgcagatggccgaggcgcat
ggcaagctgacaggccagccgggcgttgccttcgttacccgcagccccggcgccaccaac
gcggtcaatggcgtccataccgccttccaggacagttcgcccatgatcctgatcgtggga
caggtaaaacgcgcgattctggaacgcgaagccttcatggcctatgacttccgcacgatg
ttcgcccccatggcaaaatgggtggcgcagatcgacgaccccgcccgtatacccgaattc
gttcagcgcgcctgggccacggcgctgtctgggcggcgcgggccggtggtgctcgtcgtt
cccgaggacgtgctggaggagtactgcgatgtcgccccctcgatccggcccgcaagcgcg
tcccatgcaggcgccccacgccaacaggatcttgagcgtattttcggaatgctcggcgaa
gccgaacggccgctggtcgtcgtcggcggctcggattggagcgagaccgcgcgcgaggac
atccagagctttgccacccgcttgggcctgccggtggtgacgacgtttcgccgccgcgac
atcatcgaccaccgcctggactgctatgccggcgaaatcggcatcggctcgaatcccgcg
cttcttgcccatatcaaagaggcggacttcgtgctgatgctcaacgacgcgctgagcgac
gtgaacaccatcggcgcaggttatatggaggggttcacgcttttctcgatccctcacccc
aagcagaagatcgtccatgtcatggccgaccatgccgacctgaaccgggtgttccaggtt
gacttggccctggtcgccgacaacgacgccaccgccggtgcgctggcaggtcatgatgcc
cgcccggtccccacgcatgcggaatggaccgccaagctgcgggcaaccttgctggcagag
cgcgaaccccagccctgccccggcgcgatcgacctgcccggggtaatgggctggttgcgt
gagcgcttgcccgaggacgccatcgtcaccaacggggtcggcgcctatgctacctggagc
cagcgctattttccgcattaccggctacacacccagcttggtcccatcagcggcagcatg
ggctattccctgcccgcggccatagcggcgaaactggcctattccgaacgggtggtggtg
gatttcgtgggggacggctgcttccagatgagcagcgaggaactggcgacggccgtgcaa
tacggcgccaatatcgtcatcctgcttttcaacaacgggctttacggcacgatccgcatc
catgaggaaaaccgcctgaatggccgcgtgaacggcacggacctgaccaatcccgacttc
ctgctgctggcgcaagcttatggcgcccatggcgagcgggtgaccacgaccgaggagttc
gccccggcctttgagcgagccttggctgccggaaagcctgccctgatcgagatgatcatc
gaccccgaggcgatccattgccgctattcccttagcgatcttcgcgcacgccgtgcagcg
cgggcgcctgactga

DBGET integrated database retrieval system