Poecilia mexicana (shortfin molly): 106908089 Help Entry 106908089         CDS       T08022                                  Name (RefSeq) claudin-9-like   KO K06087   claudin Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei03272   Virion - Hepatitis viruses pmei04382   Cornified envelope formation pmei04514   Cell adhesion molecule (CAM) interaction pmei04530   Tight junction Brite KEGG Orthology (KO) [BR:pmei00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     106908089  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     106908089  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     106908089  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     106908089  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pmei03037]     106908089    04147 Exosome [BR:pmei04147]     106908089 Cilium and associated proteins [BR:pmei03037]  Other cilia and associated proteins   Stereociliary proteins    106908089 Exosome [BR:pmei04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    106908089   Exosomal proteins of colorectal cancer cells    106908089 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin DUF6114 DUF7937 Motif Other DBs NCBI-GeneID:  106908089 NCBI-ProteinID:  XP_014829547 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MTYRTGLQLCETYESVKQISPPHGSRAMTVTSCILCGLSLLLLIFGSDFTPCVQNQDTKP KLILAAAVGLTLAGLLVIIPVSWETNPPVLLEEMRQGASIYIGYVAGLMLILTGVLLCCF SRPGSSSFGGTVSCLRNRV NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgacatacagaaccggactgcagctgtgtgaaacgtatgaaagcgtcaagcagatctca ccgcctcatggctcccgggccatgaccgtcaccagctgcatcctctgtggtctcagcctc ctcctcctgatctttggttccgacttcaccccatgtgttcagaaccaagacaccaaaccc aaactgatcctggcggccgcagtgggcctgacactggccggcctgctggtgatcatcccg gtcagctgggagacgaatccaccagtgctgttagaggaaatgaggcagggagcgagcatc tatatcggctatgtagctggtttgatgttgatactgactggagttctgctttgctgtttc agcagacctggatccagcagctttggaggaaccgtcagctgcttaagaaacagagtttaa

DBGET integrated database retrieval system