Poecilia mexicana (shortfin molly): 106909931 Help Entry 106909931         CDS       T08022                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei03082   ATP-dependent chromatin remodeling pmei04217   Necroptosis Brite KEGG Orthology (KO) [BR:pmei00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     106909931  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     106909931  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmei03036]     106909931   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmei04147]     106909931 Chromosome and associated proteins [BR:pmei03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106909931 Exosome [BR:pmei04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106909931 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  106909931 NCBI-ProteinID:  XP_014831929 Ensembl:  ENSPMEG00000023413 UniProt:  A0A3B3Z3S2 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAAKAK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggaaagaccggcggcaaagccagagctaaggccaagacccgctcatcc cgtgcggggctccagttcccagtgggccgtgttcacaggctgctgaggaaaggaaactac gccgagcgcgtcggcgccggagctcctgtctatctggcggcggtgctcgagtacctgacc gccgagatcctggagctggctggaaacgctgcccgcgataacaagaagaccaggatcatc ccccgtcacctgcagctggccgtccgcaacgacgaggagctcaacaagctgctgggtgga gtcaccattgcacagggtggtgttctccccaacatccaggctgtcctgctgcccaagaag accgagaaagcagccaaggccaagtaa

DBGET integrated database retrieval system