Poecilia mexicana (shortfin molly): 106911171 Help Entry 106911171         CDS       T08022                                  Name (RefSeq) ras-related protein R-Ras2-like   KO K07830   Ras-related protein R-Ras2 Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei04010   MAPK signaling pathway pmei04137   Mitophagy - animal pmei04140   Autophagy - animal pmei04218   Cellular senescence pmei04371   Apelin signaling pathway pmei04625   C-type lectin receptor signaling pathway pmei04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pmei00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106911171    04371 Apelin signaling pathway     106911171  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106911171    04137 Mitophagy - animal     106911171   09143 Cell growth and death    04218 Cellular senescence     106911171   09142 Cell motility    04810 Regulation of actin cytoskeleton     106911171  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106911171  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmei04147]     106911171    04031 GTP-binding proteins [BR:pmei04031]     106911171 Exosome [BR:pmei04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    106911171   Exosomal proteins of bladder cancer cells    106911171 GTP-binding proteins [BR:pmei04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106911171 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  106911171 NCBI-ProteinID:  XP_014833417 Ensembl:  ENSPMEG00000000572 UniProt:  A0A3B3X0T2 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSGEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKVCTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSFHEVQKFHTQILRVKDRDDFPMVLIGN KADLEQHRVISREDAQAFARENKIHYMEASAKNRYNVDEAFMELVQIIRRFQEMESPPPP TQQTGKQNSRGCPCVIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtggggaagaagagagattcaaactggtggttgtgggaggaggtggagtgggcaag agcgccctgaccatccagttcatccagtcctactttgtgtcggactacgaccccaccatt gaagactcctataccaaggtgtgcactgtggatggcaaggagactcggctagacattcta gatacagcaggccaggaggagtttggtgccatgagggagcagtacatgcggtctggggaa ggcttcttactggtgtttgctctcaacgaccggggcagttttcatgaggtccagaagttc cacacccagatcctgagggtaaaagaccgagacgactttcccatggtgctgattggaaac aaggctgacctggagcagcatagagtgatctccagggaggacgctcaggcgtttgccaga gagaacaagatccactacatggaagcttctgccaagaatcgctacaatgtggatgaagct ttcatggagctggtgcagatcatcagacggtttcaggagatggagagtcctcctcctcca actcaacaaactgggaaacagaacagtcgtggctgtccctgtgtcatcctgtag

DBGET integrated database retrieval system