Poecilia mexicana (shortfin molly): 106912827 Help Entry 106912827         CDS       T08022                                  Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei04010   MAPK signaling pathway pmei04137   Mitophagy - animal pmei04140   Autophagy - animal pmei04218   Cellular senescence pmei04371   Apelin signaling pathway pmei04625   C-type lectin receptor signaling pathway pmei04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pmei00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106912827    04371 Apelin signaling pathway     106912827  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106912827    04137 Mitophagy - animal     106912827   09143 Cell growth and death    04218 Cellular senescence     106912827   09142 Cell motility    04810 Regulation of actin cytoskeleton     106912827  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106912827  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmei04147]     106912827    04031 GTP-binding proteins [BR:pmei04031]     106912827 Exosome [BR:pmei04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    106912827   Exosomal proteins of bladder cancer cells    106912827 GTP-binding proteins [BR:pmei04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106912827 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  106912827 NCBI-ProteinID:  XP_014835093 Ensembl:  ENSPMEG00000017927 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search FCPLLSLSLSRSLMQSYFVTDYDPTIEDSYTKQCVIDERPARLDILDTAGQEEFGAMREQ YMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLELQRQVTQEE GQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIR NT seq 468 nt NT seq  +upstreamnt  +downstreamnt ttttgtcctctcctctctctctctctctctcgctctctcatgcagtcatactttgtcacc gactatgatcctacgatcgaagactcttacaccaagcagtgcgtgattgatgaaaggccg gccaggctggacatcctcgacacggctggacaggaagagttcggagccatgcgagaacaa tacatgaggacaggggagggcttcctgctcgtcttctcagtcactgacagaggaagcttt gaagaaatctacaaattccaaagacagattctgcgagtcaaagacagagatgaattcccc atgatcctcgtaggcaacaaggcagatctggagctgcagagacaagtaacccaggaagag ggccagcagctggccagacagctaaaagtcacatatatggaggcttcagctaaaatccgt atgaacgtagaccaggcttttcacgagctggttagggtaatcaggtaa

DBGET integrated database retrieval system