Poecilia mexicana (shortfin molly): 106912827 Help Entry 106912827         CDS       T08022                                  Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei04010   MAPK signaling pathway pmei04137   Mitophagy - animal pmei04140   Autophagy - animal pmei04218   Cellular senescence pmei04371   Apelin signaling pathway pmei04519   Cadherin signaling pmei04625   C-type lectin receptor signaling pathway pmei04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pmei00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106912827    04371 Apelin signaling pathway     106912827   09133 Signaling molecules and interaction    04519 Cadherin signaling     106912827  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106912827    04137 Mitophagy - animal     106912827   09143 Cell growth and death    04218 Cellular senescence     106912827   09142 Cell motility    04810 Regulation of actin cytoskeleton     106912827  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106912827  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmei04147]     106912827    04031 GTP-binding proteins [BR:pmei04031]     106912827 Exosome [BR:pmei04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    106912827   Exosomal proteins of bladder cancer cells    106912827 GTP-binding proteins [BR:pmei04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106912827 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 ATP_bind_1 RHG35-p190PhoGP_pG1 Motif Other DBs NCBI-GeneID:  106912827 NCBI-ProteinID:  XP_014835093 Ensembl:  ENSPMEG00000017927 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search FCPLLSLSLSRSLMQSYFVTDYDPTIEDSYTKQCVIDERPARLDILDTAGQEEFGAMREQ YMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLELQRQVTQEE GQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIR NT seq 468 nt NT seq  +upstreamnt  +downstreamnt ttttgtcctctcctctctctctctctctctcgctctctcatgcagtcatactttgtcacc gactatgatcctacgatcgaagactcttacaccaagcagtgcgtgattgatgaaaggccg gccaggctggacatcctcgacacggctggacaggaagagttcggagccatgcgagaacaa tacatgaggacaggggagggcttcctgctcgtcttctcagtcactgacagaggaagcttt gaagaaatctacaaattccaaagacagattctgcgagtcaaagacagagatgaattcccc atgatcctcgtaggcaacaaggcagatctggagctgcagagacaagtaacccaggaagag ggccagcagctggccagacagctaaaagtcacatatatggaggcttcagctaaaatccgt atgaacgtagaccaggcttttcacgagctggttagggtaatcaggtaa

DBGET integrated database retrieval system