Poecilia mexicana (shortfin molly): 106913600 Help Entry 106913600         CDS       T08022                                  Name (RefSeq) claudin-9-like   KO K06087   claudin Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei03272   Virion - Hepatitis viruses pmei04382   Cornified envelope formation pmei04514   Cell adhesion molecule (CAM) interaction pmei04530   Tight junction Brite KEGG Orthology (KO) [BR:pmei00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     106913600  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     106913600  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     106913600  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     106913600  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pmei03037]     106913600    04147 Exosome [BR:pmei04147]     106913600 Cilium and associated proteins [BR:pmei03037]  Other cilia and associated proteins   Stereociliary proteins    106913600 Exosome [BR:pmei04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    106913600   Exosomal proteins of colorectal cancer cells    106913600 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin L_HMGIC_fpl Claudin_2 TMEM37 AA_permease_2 Pox_A14 Caps_syn_GfcC_C DUF2207_C Motif Other DBs NCBI-GeneID:  106913600 NCBI-ProteinID:  XP_014835655 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search EVHYGLWKACVKQGTGPQECITYDDSLIHSKMHSLRALTIISCMLGILSLLLLIFGSDFT PCVQNQDTKPKMILAAAVGLLLAGLLVIIPVSWETHDMRNMRNGPEEMMPGASIYIGFIA GLMLMLTGGLLCYLSRSSSSGGTASFFSNRV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt gaagttcattacggtctgtggaaggcgtgtgtgaagcagggaactggaccgcaggagtgc ataacgtatgatgactccctgatacactctaaaatgcattccttaagggccttgaccatc atcagctgcatgctgggtattctcagcctcctcctcctgatctttggttccgacttcacc ccatgtgttcagaaccaagacaccaaacccaaaatgatcctggcggccgcagtggggctg ctgctggccggcctgctggtgatcatcccggtcagctgggagacacatgatatgagaaat atgagaaatggaccagaggaaatgatgccgggagcgagcatctatatcggctttatagct ggtttgatgttgatgctgactggaggtctgctctgctacttaagcagatccagcagctct ggaggaaccgccagcttcttcagcaacagagtttaa

DBGET integrated database retrieval system