Poecilia mexicana (shortfin molly): 106915289 Help Entry 106915289         CDS       T08022                                  Symbol apln Name (RefSeq) apelin   KO K05225   apelin Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei04080   Neuroactive ligand-receptor interaction pmei04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:pmei00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     106915289 (apln)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     106915289 (apln)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmei04052]     106915289 (apln) Cytokines and neuropeptides [BR:pmei04052]  Neuropeptides   GPCR binding    106915289 (apln) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Apelin PDGLE Motif Other DBs NCBI-GeneID:  106915289 NCBI-ProteinID:  XP_014838256 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MNVKILTLVIVLLVSLLCPAGAGPMASTEHGRGLEEAATVRKMAQQNPVRGGQTHRPAKR RRPRPRLSHKGPMPF NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgtcctgcc ggtgctggtcccatggcctccacggagcatggcagagggctggaagaggcagctacagtg agaaaaatggcccagcagaacccagtgagaggcggtcagacccacagaccagccaagaga agacgcccacggccccgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system