Poecilia mexicana (shortfin molly): 106922621 Help Entry 106922621         CDS       T08022                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei04382   Cornified envelope formation pmei05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmei00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     106922621  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106922621  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmei04147]     106922621 Exosome [BR:pmei04147]  Exosomal proteins   Exosomal proteins of microglial cells    106922621 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 Nop5_N EF-hand_8 CRISPR_Cas9_WED DEK_C Motif Other DBs NCBI-GeneID:  106922621 NCBI-ProteinID:  XP_014850668 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MTELEKSMESLITVFHRYAKEGGNKTTLSKKELKKLIEKELPNFLTTQKNPDTVSSIIKD LDQNKDDELDFEEFVPFVAGLTIACEKHYALHHENKGKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaccgagttggagaaatccatggagtccctgatcacggtgtttcaccgttacgccaag gaaggtggcaataaaacgaccctgagcaagaaggagctgaaaaagctgattgagaaagag ttgcccaacttcttaacaacccagaaaaaccccgacacggtgtcgagcatcatcaaggat ctggaccagaacaaggacgatgagctggactttgaggaatttgttcccttcgtcgctgga ctgacaatcgcctgtgaaaagcattacgctttgcaccacgaaaacaagggcaagaagtga

DBGET integrated database retrieval system