Poecilia mexicana (shortfin molly): 106926268 Help Entry 106926268         CDS       T08022                                  Name (RefSeq) claudin-19-like   KO K06087   claudin Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei03272   Virion - Hepatitis viruses pmei04382   Cornified envelope formation pmei04514   Cell adhesion molecules pmei04530   Tight junction Brite KEGG Orthology (KO) [BR:pmei00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     106926268  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     106926268  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     106926268  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     106926268  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pmei03037]     106926268    04147 Exosome [BR:pmei04147]     106926268    04515 Cell adhesion molecules [BR:pmei04515]     106926268 Cilium and associated proteins [BR:pmei03037]  Other cilia and associated proteins   Stereociliary proteins    106926268 Exosome [BR:pmei04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    106926268   Exosomal proteins of colorectal cancer cells    106926268 Cell adhesion molecules [BR:pmei04515]  Immunoglobulin superfamily   L1 family    106926268 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF4064 DUF6535 MFS_1 Motif Other DBs NCBI-GeneID:  106926268 NCBI-ProteinID:  XP_014856561 Ensembl:  ENSPMEG00000010672 UniProt:  A0A3B3YHD2 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MASSGLQIVGFLLSLVGVSATIAATFMVEWGKESQAKHRTYDGLWMSCSGTSERATCENY KYLLKLPIEVQVTRALILVSLFLSAMALIVSILGMKCTRFMDAMPQSKVKAAVCGGGLFI LAGILTIIVTSWYVSRMVEVNEKAHRLQK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccagctctggactgcagatcgttggttttctcctctccttagttggagtctctgct actattgccgctactttcatggtcgagtggggaaaggagagccaagcaaaacaccgcacc tatgacggtctgtggatgtcctgcagcggcacctccgagagggccacctgcgaaaattac aagtatctactgaaactcccaattgaggtccaggtcactagagcactgattctggtcagc ctcttcctctccgccatggcgctgattgtctccatactgggaatgaagtgcactcgcttc atggatgccatgccacagagcaaagtcaaagcagctgtctgcggaggagggctgttcata ctcgctggtatcttgaccatcattgttacctcctggtacgtcagtaggatggttgaggtc aacgaaaaggcacatcgactccaaaagtaa

DBGET integrated database retrieval system