Poecilia mexicana (shortfin molly): 106928221 Help Entry 106928221         CDS       T08022                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei04010   MAPK signaling pathway pmei04068   FoxO signaling pathway pmei04081   Hormone signaling pmei04114   Oocyte meiosis pmei04140   Autophagy - animal pmei04150   mTOR signaling pathway pmei04810   Regulation of actin cytoskeleton pmei04910   Insulin signaling pathway pmei04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:pmei00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106928221    04068 FoxO signaling pathway     106928221    04150 mTOR signaling pathway     106928221   09133 Signaling molecules and interaction    04081 Hormone signaling     106928221  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106928221   09143 Cell growth and death    04114 Oocyte meiosis     106928221   09142 Cell motility    04810 Regulation of actin cytoskeleton     106928221  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     106928221    04914 Progesterone-mediated oocyte maturation     106928221  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmei04052]     106928221 Cytokines and neuropeptides [BR:pmei04052]  Neuropeptides   Unclassified    106928221 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  106928221 NCBI-ProteinID:  XP_014859806 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MARVPWTFSMLFLLVLHSPGASLAPNQHLCGSHLVDALYFICGERGFYYSPSRVHKRDLE NLLGFLAKRARAEERLWRVLAARDEPKVKRGIVEQCCHKPCSIHHLEDYCN NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagggtaccatggacattctccatgctgttcctgcttgtgctccactctccaggg gcctcgttggccccaaaccagcacctgtgtggctctcacctggtcgacgccctctacttc atctgtggggagcgaggattttactacagtccgagccgagtccacaagcgggacctggag aatctgcttgggttcctggcgaaaagggccagagcggaggagcggctgtggagggttctg gctgcccgtgacgagcccaaggtgaagagaggcatcgtggagcagtgctgccataagccg tgcagcattcaccacctggaggactactgcaactga

DBGET integrated database retrieval system