Poecilia mexicana (shortfin molly): 106932679 Help Entry 106932679         CDS       T08022                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism pmei  Poecilia mexicana (shortfin molly) Pathway pmei03030   DNA replication pmei03410   Base excision repair pmei03420   Nucleotide excision repair pmei03430   Mismatch repair pmei03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pmei00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     106932679 (pold4)    03410 Base excision repair     106932679 (pold4)    03420 Nucleotide excision repair     106932679 (pold4)    03430 Mismatch repair     106932679 (pold4)    03440 Homologous recombination     106932679 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pmei03032]     106932679 (pold4)    03400 DNA repair and recombination proteins [BR:pmei03400]     106932679 (pold4) DNA replication proteins [BR:pmei03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     106932679 (pold4) DNA repair and recombination proteins [BR:pmei03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       106932679 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      106932679 (pold4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  106932679 NCBI-ProteinID:  XP_014866974 Ensembl:  ENSPMEG00000014652 UniProt:  A0A3B3XBX3 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MTTKRGLITDSFKVLKKTRRGGKRKKTPTPPPAQQEDVTTTVREEEMQQLKQFDLDWRFG PCTGISRMQRWERAKLHGLNPPEEIKELLLQTLDDPEYSMSLWREYPF NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacaacaaaacgtggactgataaccgattcatttaaagtgctgaagaaaacaaggaga gggggaaagcgaaagaagactcccacgcctcctccagcacagcaagaagatgtcactaca actgtcagagaggaggagatgcagcagctcaaacagtttgacctggactggagatttggg ccctgcacaggcatcagcagaatgcagaggtgggagagagcgaagcttcatggtctgaac ccacctgaggaaatcaaagagctgctgctgcaaacactcgatgatcctgagtactccatg agcctctggagagaatatccgttctga

DBGET integrated database retrieval system