KEGG   Phyllobacterium meliloti: LLE53_009095
Entry
LLE53_009095      CDS       T11258                                 
Name
(GenBank) ABC transporter permease
  KO
K25187  pyoluteorin transport system permease protein
Organism
pmel  Phyllobacterium meliloti
Brite
KEGG Orthology (KO) [BR:pmel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmel02000]
    LLE53_009095
Transporters [BR:pmel02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Pyoluteorin transporter
    LLE53_009095
SSDB
Motif
Pfam: ABC2_membrane_3 ABC2_membrane ABC2_membrane_2 ABC2_membrane_4
Other DBs
NCBI-ProteinID: UGX84672
LinkDB
Position
1840584..1841705
AA seq 373 aa
MIQSLFRIIALIRKELLAMLKDPKSRITLVLPPILQCLIFGYAASYDLNNVPYAILDHDH
SAASIALIAKLDGSGTFSRIATLQRTSDIASFINNKRVLLVLVIDQDFEKNLMAGMPAKL
QMIADGRNSNTAGTAQGYVSSIVGDFTTRWREENGQAANAGVKVTTRAWYNPSLETRWNM
IPSLIGTITMMMTMMLTAMSVAREREAGTLDQLLVTPFRPSEIMVGKALPSMMVGLTQST
MILLVAQLWFQIPFSGSYLILYMGLILFLAAAVGIGLFLSSLAANMQQAMIFSFVLLMPF
MLLSGLTAPIGNMPDVLQYFTLINPLRYAISITHQVYLEGAGVGQLLPEMLALIAISAVT
LPVSSWLFRHRLV
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgatccaatcgcttttccgtatcatcgccctcatccgcaaggaattgctggcgatgctc
aaagatcccaaaagccgtatcacactggtgctgccgccgatcttgcaatgccttatcttc
ggctatgccgcgagctatgatctcaacaatgtgccctatgcgatcctcgatcatgatcac
agcgcggcatcgattgcgctcatcgccaagcttgacggttcgggcacgtttagccgcatc
gccaccctgcaacggacaagcgatattgccagttttatcaacaataagcgggtgcttctg
gtgctcgtcattgatcaggatttcgaaaagaacctgatggctggcatgccggccaaattg
cagatgatcgccgacgggcgcaattccaatactgccggcaccgcacagggctatgtgagt
tcgattgttggcgacttcaccacccgctggcgtgaagaaaacggtcaggctgccaatgca
ggtgtcaaggtaacaacccgcgcctggtacaatccaagccttgaaacgcgctggaatatg
atcccctcactgatcggcaccatcaccatgatgatgacgatgatgctgacggccatgtcc
gtcgcgcgcgagcgggaggccggaacgctggaccaactgctcgtcacacccttccgcccg
tcggaaatcatggtgggcaaggccctgccctcgatgatggtggggctgacgcagtcaaca
atgatcctgcttgtggcgcagctctggttccagatccccttctccggctcctatctcatc
ctctatatgggactgatcctgtttctggccgcagcggtgggaatcggcctgtttctctcc
tcccttgccgcaaacatgcagcaggcgatgattttctcgtttgttctgctgatgccgttc
atgctgctatcgggcctgacagcgcccatcggcaacatgccggatgttttgcaatatttc
acgctgatcaatccgctgcgctatgccatcagcatcacgcatcaggtctatctggaaggt
gcgggagttggtcagctcttaccggaaatgctggcgctcatcgccatttcagcggtgaca
ctgccagtatcatcatggctgttccggcatcggttggtttga

DBGET integrated database retrieval system