Pseudodesulfovibrio methanolicus: V8V93_07195 Help Entry V8V93_07195       CDS       T10565                                  Name (GenBank) 4Fe-4S binding protein   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism pmen  Pseudodesulfovibrio methanolicus Pathway pmen00010   Glycolysis / Gluconeogenesis pmen00020   Citrate cycle (TCA cycle) pmen00620   Pyruvate metabolism pmen00633   Nitrotoluene degradation pmen00640   Propanoate metabolism pmen00650   Butanoate metabolism pmen00680   Methane metabolism pmen00720   Other carbon fixation pathways pmen01100   Metabolic pathways pmen01110   Biosynthesis of secondary metabolites pmen01120   Microbial metabolism in diverse environments pmen01200   Carbon metabolism pmen01210   2-Oxocarboxylic acid metabolism Module pmen_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:pmen00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     V8V93_07195    00020 Citrate cycle (TCA cycle)     V8V93_07195    00620 Pyruvate metabolism     V8V93_07195    00640 Propanoate metabolism     V8V93_07195    00650 Butanoate metabolism     V8V93_07195   09102 Energy metabolism    00720 Other carbon fixation pathways     V8V93_07195    00680 Methane metabolism     V8V93_07195   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     V8V93_07195 Enzymes [BR:pmen01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase (ferredoxin)      V8V93_07195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_6 Fer4_21 Fer4_16 Fer4_17 Fer4_10 Fer4_9 Fer4_4 LdpA_Fe-S-bd Fer4_8 Fer4_3 Fer4_ETF_QO Motif Other DBs NCBI-ProteinID:  WWX23990 UniProt:  A0ABZ2IZ87 LinkDB All DBs Position 1559229..1559456 Genome browser AA seq 75 aa AA seqDB search MANEGMYIVDTGSWRAFRPVVNAENCVDCGICAMYCPVNCISGGEGLAVIDLTYCKGCGL CRVECPKDAIDWVEE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccaatgaaggaatgtacatcgtggacaccggctcgtggcgcgcgttccggccggtg gtgaatgcggagaactgcgtggattgcggtatctgcgccatgtattgccccgtgaactgc atcagcggcggcgaaggcctggcggtcatcgacctcacctactgcaaggggtgcgggctg tgccgcgtggagtgtcccaaagatgcaatcgactgggtcgaggagtga

DBGET integrated database retrieval system