Parabacteroides merdae: INE87_00122 Help Entry INE87_00122       CDS       T07751                                  Name (GenBank) 4Fe-4S binding domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pmer  Parabacteroides merdae Pathway pmer00020   Citrate cycle (TCA cycle) pmer00720   Other carbon fixation pathways pmer01100   Metabolic pathways pmer01110   Biosynthesis of secondary metabolites pmer01120   Microbial metabolism in diverse environments pmer01200   Carbon metabolism pmer01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pmer00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     INE87_00122   09102 Energy metabolism    00720 Other carbon fixation pathways     INE87_00122 Enzymes [BR:pmer01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      INE87_00122 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_6 Fer4_4 Fer4_16 Fer4_17 LdpA_Fe-S-bd Fer4_15 Fer4_8 Fer4_22 Fer4_13 Fer4_3 Fer4_18 Chordopox_G2 Motif Other DBs NCBI-ProteinID:  QUT47705 LinkDB All DBs Position complement(129038..129271) Genome browser AA seq 77 aa AA seqDB search MAKIKGAVVVNTERCKGCNLCVVACPSDVLELHPREVNNKGYHYVYMKNPDDCIGCASCG LVCPDGCLTIYKKRIDN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcgaagataaaaggagctgttgttgtaaacacagagcgatgcaaaggatgtaacctc tgcgtagtagcctgcccgtcggatgttctcgaattgcacccgcgtgaagtaaacaacaag ggataccattatgtgtacatgaaaaaccccgatgactgcatcggttgtgcaagctgcggg ttggtttgtccggacggttgtttgaccatctacaagaagagaattgacaattga

DBGET integrated database retrieval system