Pseudoxanthomonas mexicana: H4W19_02820
Help
Entry
H4W19_02820 CDS
T06805
Name
(GenBank) LD-carboxypeptidase
KO
K01297
muramoyltetrapeptide carboxypeptidase [EC:
3.4.17.13
]
Organism
pmex
Pseudoxanthomonas mexicana
Brite
KEGG Orthology (KO) [BR:
pmex00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
pmex01002
]
H4W19_02820
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
pmex01011
]
H4W19_02820
Enzymes [BR:
pmex01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.17 Metallocarboxypeptidases
3.4.17.13 muramoyltetrapeptide carboxypeptidase
H4W19_02820
Peptidases and inhibitors [BR:
pmex01002
]
Serine peptidases
Family S66
H4W19_02820
Peptidoglycan biosynthesis and degradation proteins [BR:
pmex01011
]
Precursor biosynthesis
Carboxypeptidase
H4W19_02820
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S66
Peptidase_S66C
Motif
Other DBs
NCBI-ProteinID:
QND80751
UniProt:
A0ABX6RD32
LinkDB
All DBs
Position
559371..560420
Genome browser
AA seq
349 aa
AA seq
DB search
MHRRHFLGSAALAATSLMLPWVGGAQAFAAAPRRRLLPLALNPGDTIGLVSPSAATDEPL
DLQLAQEAMEALGLKVKVGPHLGARRGHLAGSDAERAGDLNAMFADREVKAIVCARGGSG
AARLLPLLDYAAIRRHPKILLGYSDITALHNALLSQAGLVSFHGPIGIGSWNSFNADQFR
RVFFQREQMEYRNSADKGDELVQRRNRTVTITGGKAQGELVGGNLSVLVALAGSPYLPDF
RGKILFLEDVSEAPYRIDRMLSTLRLMGALDQVAGVIFGECTECDPGNGYGSLTLPQIFD
DYFKPLKVPAYRGAMIGHIRQQFIVPVGGRVEMDADAGTFRMLEPVFAG
NT seq
1050 nt
NT seq
+upstream
nt +downstream
nt
atgcacagacgacatttcctcgggagtgcggcactggccgccacgtccttgatgctgccg
tgggtcggcggcgcgcaggcgttcgcggcggcgccgcgcaggcgcctgctgccgctggca
ctgaatcccggcgacaccatcggcctggtcagtccgtccgccgccaccgacgagccgctg
gacctgcagctggcgcaggaagcgatggaggccctgggcctgaaggtgaaggtggggccg
catctgggcgcccggcgcgggcatctggccggcagcgacgccgagcgtgcgggcgacctg
aacgcgatgttcgccgaccgcgaggtcaaggcgatcgtctgcgcgcggggcggttccggc
gcggcgcgcctgctgccgctgctggactacgcggcgatccgccgccatccgaagatcctg
ctggggtattcggacatcaccgcgctgcacaacgcgctgctgtcgcaggccggactggtc
agcttccacggccccatcggcatcggcagctggaacagcttcaatgcggaccagttccgc
cgcgtgttcttccagcgcgaacagatggaataccgcaacagcgcggacaagggcgacgaa
ctggtgcagcgacgcaaccgcacggtcaccatcaccggcggcaaggcgcagggtgaactg
gtgggcggcaatctgtcggtgctggtggcgctggccggctcgccgtacctgccggatttc
cgcggcaagatcctgttcctggaagacgtttccgaagcgccgtaccgcatcgaccgcatg
ctcagcacgctgcggctgatgggtgcgctggaccaggtggccggcgtgatcttcggcgag
tgcaccgagtgcgatccgggcaacggctacggctcgctgacgctgccgcagatcttcgac
gactacttcaagccgctgaaggtgcccgcctacagaggcgcgatgatcggccacatccgc
cagcagttcatcgtgccggtcggcggccgggtggaaatggacgcggacgcgggcacgttc
cggatgctggagccggtgttcgcgggctag
DBGET
integrated database retrieval system