Prochlorococcus marinus MIT 9303: P9303_15051 Help Entry P9303_15051       CDS       T00466                                  Name (GenBank) Conserved hypothetical protein   KO K03666   host factor-I protein Organism pmf  Prochlorococcus marinus MIT 9303 Pathway pmf02024   Quorum sensing pmf03018   RNA degradation Brite KEGG Orthology (KO) [BR:pmf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     P9303_15051  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     P9303_15051  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pmf03019]     P9303_15051    03036 Chromosome and associated proteins [BR:pmf03036]     P9303_15051 Messenger RNA biogenesis [BR:pmf03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      P9303_15051 Chromosome and associated proteins [BR:pmf03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     P9303_15051 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Motif Other DBs NCBI-ProteinID:  ABM78249 UniProt:  A2C9T9 LinkDB All DBs Position 1306220..1306441 Genome browser AA seq 73 aa AA seqDB search METPPLNPSLPGIRLIQGWVRDEIPLSLELADGLRLEGRLLWQDPEFLALERPGSSQPVL INRRAVLIIRPLG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggagaccccccctctcaatcccagccttccagggattcgtctgattcagggttgggtg cgcgatgagatccctctcagtcttgaattagctgatgggctccgattggaaggccgcttg ctatggcaggacccggaattccttgccctggaacggcctggatcgagtcaacctgtgctg attaaccgtcgggctgtactgataattcgtccactgggctaa

DBGET integrated database retrieval system