Prochlorococcus marinus MIT 9303: P9303_25291 Help Entry P9303_25291       CDS       T00466                                  Symbol psbE Name (GenBank) Cytochrome b559 alpha-subunit   KO K02707   photosystem II cytochrome b559 subunit alpha Organism pmf  Prochlorococcus marinus MIT 9303 Pathway pmf00195   Photosynthesis pmf01100   Metabolic pathways Module pmf_M00161   Photosystem II pmf_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:pmf00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     P9303_25291 (psbE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pmf00194]     P9303_25291 (psbE) Photosynthesis proteins [BR:pmf00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     P9303_25291 (psbE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  ABM79260 UniProt:  A2CCQ0 LinkDB All DBs Position 2225388..2225636 Genome browser AA seq 82 aa AA seqDB search MAAGSTGERPFFEIVTSIRYWVIHAVTLPSIFLAGYLFVSTGLAYDTFGTPRPDAYFQAS ESKAPVVSQRYEAKSQLDLRLQ NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctgctggctccaccggggaacgcccttttttcgagatcgtcactagcatccgctac tgggtgatccacgccgttaccctgccgtcgatcttcctcgccggctacctgtttgtgtcc acgggccttgcctatgacacattcggcacacctcgccctgatgcctatttccaggcaagc gaaagtaaggctcctgtcgttagccaacgctacgaagccaaatcccaactcgacctgcgc ctgcaataa

DBGET integrated database retrieval system