Prochlorococcus marinus MIT 9303: P9303_25301 Help Entry P9303_25301       CDS       T00466                                  Symbol psbF Name (GenBank) Cytochrome b559 beta-subunit   KO K02708   photosystem II cytochrome b559 subunit beta Organism pmf  Prochlorococcus marinus MIT 9303 Pathway pmf00195   Photosynthesis pmf01100   Metabolic pathways Module pmf_M00161   Photosystem II pmf_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:pmf00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     P9303_25301 (psbF)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pmf00194]     P9303_25301 (psbF) Photosynthesis proteins [BR:pmf00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     P9303_25301 (psbF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  ABM79261 UniProt:  A2CCQ1 LinkDB All DBs Position 2225640..2225789 Genome browser AA seq 49 aa AA seqDB search MAQSSSAPLQALNVRVYPIFTVRWLAVHVLGVPTVFFLGAITAMQLIRR NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctcaatcttcttctgcaccgcttcaagctctcaacgtccgtgtctatccgattttc acggtgcgttggcttgctgtacacgtcctgggtgtacccacagtatttttccttggcgcc ataaccgccatgcagctcatccgtcgctga

DBGET integrated database retrieval system