Prochlorococcus marinus MIT 9301: P9301_09501 Help Entry P9301_09501       CDS       T00488                                  Name (GenBank) Hypothetical protein   KO K06024   segregation and condensation protein B Organism pmg  Prochlorococcus marinus MIT 9301 Brite KEGG Orthology (KO) [BR:pmg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmg03036]     P9301_09501 Chromosome and associated proteins [BR:pmg03036]  Prokaryotic type   Chromosome partitioning proteins    Condensin-like complex     P9301_09501 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SMC_ScpB Staph_reg_Sar_Rot Motif Other DBs NCBI-ProteinID:  ABO17573 UniProt:  A3PCU8 LinkDB All DBs Position complement(818055..818312) Genome browser AA seq 85 aa AA seqDB search MKTSELRTLATIAIKKKILQSDLILLRGSGAYDHIKELLEKKFIVKRKQKDGRSYWLSLS EKFFQTFAVSNEYLSNIGSGNNKQQ NT seq 258 nt NT seq  +upstreamnt  +downstreamnt ttgaaaacatccgaattaaggacattggcaactattgcgatcaaaaaaaagatacttcaa tcagatcttatacttcttcgaggttcaggtgcctatgatcatattaaagaattattagaa aagaaattcatcgtcaaacggaagcaaaaagatgggagatcatattggctatcattatca gaaaagttttttcaaacttttgctgtaagtaatgaatatctctcaaatataggaagcggt aataataagcagcaataa

DBGET integrated database retrieval system