KEGG   Prochlorococcus marinus MIT 9301: P9301_09991
Entry
P9301_09991       CDS       T00488                                 
Name
(GenBank) Conserved hypothetical protein
  KO
K06891  ATP-dependent Clp protease adaptor protein ClpS
Organism
pmg  Prochlorococcus marinus MIT 9301
Brite
KEGG Orthology (KO) [BR:pmg00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    P9301_09991
SSDB
Motif
Pfam: ClpS Alkyl_sulf_C
Other DBs
NCBI-ProteinID: ABO17622
UniProt: A3PCZ7
LinkDB
Position
869384..869671
AA seq 95 aa
MFNSLGTVLDPKKSKAKYPEARVIVLDDNFNTFQHVANCLLTIIPSMSEQRAWDLTIKVD
KTGSAEVWRGNLEQAELYHEQLFSKGLTMAPIEKT
NT seq 288 nt   +upstreamnt  +downstreamnt
atgtttaattcactcggcacagtcttagatcccaaaaaatccaaagcaaaatatccagaa
gcaagggttatagttcttgatgacaattttaatacttttcagcatgtcgcaaattgtctt
ctaacaataatcccaagcatgagtgaacaaagggcatgggatctaaccataaaagttgac
aagacaggatctgcagaggtatggagaggtaatcttgaacaggcagagctatatcatgag
caactattcagcaaaggattaacaatggctccaattgagaaaacataa

DBGET integrated database retrieval system