Prochlorococcus marinus MIT 9215: P9215_17231 Help Entry P9215_17231       CDS       T00598                                  Symbol atpE Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism pmh  Prochlorococcus marinus MIT 9215 Pathway pmh00190   Oxidative phosphorylation pmh00195   Photosynthesis pmh01100   Metabolic pathways Module pmh_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pmh00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     P9215_17231 (atpE)    00195 Photosynthesis     P9215_17231 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pmh00194]     P9215_17231 (atpE) Photosynthesis proteins [BR:pmh00194]  Photosystem and electron transport system   F-type ATPase [OT]    P9215_17231 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  ABV51336 UniProt:  A8G6V5 LinkDB All DBs Position complement(1469712..1469957) Genome browser AA seq 81 aa AA seqDB search MDSITSAASVVAAGLAVGLGAIGPGLGQGNAAQGAVEGIARQPEAEGKIRGTLLLSFAFM ESLTIYGLVVALVLLFANPFS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggattcgattacttccgctgcatcagttgtagctgctggtttagcagttggtctaggt gctattggcccaggtcttggacaaggtaacgcagctcaaggtgctgttgagggtatagcc cgtcaaccagaagctgaaggtaaaatcagaggaactcttcttttatctttcgcttttatg gagtcattaacaatttacggattagttgtggctttggtactactttttgcgaatcctttt tcctaa

DBGET integrated database retrieval system