Prochlorococcus marinus MIT 9215: P9215_18821 Help Entry P9215_18821       CDS       T00598                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism pmh  Prochlorococcus marinus MIT 9215 Pathway pmh01100   Metabolic pathways pmh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P9215_18821 (acpP)    00074 Mycolic acid biosynthesis     P9215_18821 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P9215_18821 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Delta_lysin Motif Other DBs NCBI-ProteinID:  ABV51495 UniProt:  A8G7B4 LinkDB All DBs Position 1619617..1619856 Genome browser AA seq 79 aa AA seqDB search MSQEILEKVCSIVSEQLSVEAGEVKSDSNFQNDLGADSLDTVELVMALEEAFDIEIPDEA AEGIATVGDAVKFIEEKKG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcacaagaaatcctcgaaaaagtgtgttctattgtttcagaacaactaagcgttgaa gcaggagaagtcaaatcagattcaaatttccaaaatgatttaggcgcagattctcttgat accgttgaattagttatggctcttgaagaagcatttgatattgaaatccctgatgaagca gctgaaggaatcgcaactgttggcgatgcagtaaaattcatcgaagaaaaaaaaggttag

DBGET integrated database retrieval system