Ectopseudomonas mendocina NK-01: MDS_0144 Help Entry MDS_0144          CDS       T01473                                  Name (GenBank) TatA   KO K03116   sec-independent protein translocase protein TatA Organism pmk  Ectopseudomonas mendocina NK-01 Pathway pmk03060   Protein export pmk03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pmk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MDS_0144  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     MDS_0144  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pmk02044]     MDS_0144 Secretion system [BR:pmk02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    MDS_0144 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AEB56175 LinkDB All DBs Position 158820..158996 Genome browser AA seq 58 aa AA seqDB search MMGLSVWKLLIIALLVMMLFGTSRLRSIGSDLGGALSGFRRSMREEPVDGDEPRRELK NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atgatgggcttgagtgtgtggaaactcctgatcatcgccctgctggtgatgatgctgttc ggcaccagccgcctgcgcagcattggctctgacctgggcggtgcgctcagcggctttcgc cgctcgatgcgtgaggagcccgtcgacggcgacgaaccccggcgggaattgaagtag

DBGET integrated database retrieval system