Ectopseudomonas mendocina NK-01: MDS_0627 Help Entry MDS_0627          CDS       T01473                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism pmk  Ectopseudomonas mendocina NK-01 Pathway pmk01100   Metabolic pathways pmk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MDS_0627    00074 Mycolic acid biosynthesis     MDS_0627   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MDS_0627 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEB56658 LinkDB All DBs Position complement(671546..671806) Genome browser AA seq 86 aa AA seqDB search MSDLQREIKNLIIDALGLEDMSADDIGAEQTLFGEGLGLDSVDALELGLAIQKRFGIKID AEAKDTRKHFANVASLAAFVSAQQTA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaacgtgaaatcaagaacctgatcatcgatgccctcggcctcgaggac atgagcgccgacgacattggcgcggaacagaccctgttcggcgaaggcctcggcctggac tcggtggacgcgctggagcttgggctggcgatccagaagcgcttcggcatcaagatcgac gccgaagccaaggacactcgcaagcacttcgccaatgtcgcgagcctggctgcgttcgtt tccgcccagcaaaccgcttga

DBGET integrated database retrieval system