Pseudomonas mendocina NK-01: MDS_3309 Help Entry MDS_3309          CDS       T01473                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pmk  Pseudomonas mendocina NK-01 Brite KEGG Orthology (KO) [BR:pmk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmk03036]     MDS_3309 Chromosome and associated proteins [BR:pmk03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     MDS_3309 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC YabA HALZ ZapB Motif Other DBs NCBI-ProteinID:  AEB59340 LinkDB All DBs Position complement(3658063..3658341) Genome browser AA seq 92 aa AA seqDB search MRSPYWLFIVLILLFAGLQYRLWVGEGSLAQVSRLQQQIAEQQGENERLLERNRILEAEV MELKRGMETVEERARQELGMLKEGETLYLLTE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgtagtccgtattggctgttcatcgtgctgatcctgttgtttgccggtctgcagtat cgtctgtgggtcggcgagggcagtcttgcacaggttagccgcctgcagcagcagatcgcc gagcagcaaggcgagaacgagcgcctgttggagcgcaaccgcatcctcgaggccgaggtg atggaactcaagcgcggtatggaaaccgttgaagagcgcgcgcggcaggagttgggcatg ctcaaagagggcgaaaccctctacctgctgaccgaatga

DBGET integrated database retrieval system