Candidatus Phytoplasma mali: ATP_00184 Help Entry ATP_00184         CDS       T00729                                  Symbol groES Name (GenBank) chaperonin 10kDa, small subunit   KO K04078   chaperonin GroES Organism pml  Candidatus Phytoplasma mali Brite KEGG Orthology (KO) [BR:pml00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pml03110]     ATP_00184 (groES)    03029 Mitochondrial biogenesis [BR:pml03029]     ATP_00184 (groES) Chaperones and folding catalysts [BR:pml03110]  Heat shock proteins   HSP10    ATP_00184 (groES) Mitochondrial biogenesis [BR:pml03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     ATP_00184 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 FAINT ADH_N Motif Other DBs NCBI-ProteinID:  CAP18371 UniProt:  B3R0K7 LinkDB All DBs Position 236678..236941 Genome browser AA seq 87 aa AA seqDB search MKMLIRPLEDNVILEFKIEKNTTDSGIIVNTQEKEKSSVGIVIAVGPKVSEIKKNDEVIY KNYSGNKIKIEEKEYLVISSKDILALL NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgaagatgttgattagacctttagaagataatgtaattttagaatttaaaattgaaaaa aatactacagatagcggaattattgtaaatactcaagaaaaagaaaaatcatcagttgga atagttattgcagtaggaccaaaagtatcagaaattaaaaaaaatgatgaagtaatttac aaaaattattcaggtaataaaattaaaattgaagaaaaagaatatttagtaatttcttcg aaagatattttagctctattgtaa

DBGET integrated database retrieval system