Prochlorococcus marinus NATL2A: PMN2A_1663 Help Entry PMN2A_1663        CDS       T00267                                  Name (GenBank) cytochrome b559, alpha subunit   KO K02707   photosystem II cytochrome b559 subunit alpha Organism pmn  Prochlorococcus marinus NATL2A Pathway pmn00195   Photosynthesis pmn01100   Metabolic pathways Module pmn_M00161   Photosystem II pmn_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:pmn00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     PMN2A_1663  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pmn00194]     PMN2A_1663 Photosynthesis proteins [BR:pmn00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     PMN2A_1663 SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559a Cytochrom_B559 DUF2374 Motif Other DBs NCBI-ProteinID:  AAZ59151 UniProt:  Q46H81 LinkDB All DBs Position 331219..331467 Genome browser AA seq 82 aa AA seqDB search MAAGSTGERPFFEIITSVRYWIIHAVALPAIFVAGFLFVSSGLAYDAFGTPRPDTYFQAG ESKAPVVVQRFDSKAELDTRLK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggctgccggctctaccggggaacgcccgttttttgagatcattactagtgtccgctat tggattatccatgcggtagcacttcctgcgatcttcgtggcaggattcttatttgtgtct tctgggcttgcctacgacgcttttggaactcctagaccagatacgtattttcaggctgga gaaagcaaagctcctgttgttgttcagcgctttgattccaaggcggaacttgacacgcgt ctgaaataa

DBGET integrated database retrieval system