KEGG   Petrotoga mobilis: Pmob_1143
Entry
Pmob_1143         CDS       T00621                                 
Name
(GenBank) hypothetical protein
  KO
K21369  mannosylglucosyl-3-phosphoglycerate synthase [EC:2.4.1.270]
Organism
pmo  Petrotoga mobilis
Brite
KEGG Orthology (KO) [BR:pmo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pmo01003]
    Pmob_1143
Enzymes [BR:pmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.270  mannosylglucosyl-3-phosphoglycerate synthase
     Pmob_1143
Glycosyltransferases [BR:pmo01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   Pmob_1143
SSDB
Motif
Pfam: Glycos_transf_1 Glyco_transf_4
Other DBs
NCBI-ProteinID: ABX31862
UniProt: A9BHJ0
LinkDB
Position
1224823..1226340
AA seq 505 aa
MNNLYIFHYHYIKGGVSTVVRNIVKSLKDAYKITLFGSKKMGIDGIEEVLSYENVDFIDF
PELGYIYYDSTDYKTFLELKESIKNKLNNYHDERAIYWAHNYNLGKNPAFTEAFKEFITT
KNIPTIIQIHDFPECARWENYSFIRKFINSSLYPIRKNIQYATINLSDYNRLIKCGIPSE
NAFYLPNAVEFAKNKDKIDDIDKDEVINKLKKLGYNVDPTNKNILYPTRTIRRKNILEAV
LINRLYGKSNLLVTLPANSDKERPYEKVVKETFESEKVKGAWAISAKDPSLFPYILNISD
LFFSSSVLEGFGMIYLESKFNEKNFLTRKLDVIEDFKNIKEISYYDRFLVSLSPKEINKV
KEKYEEQINKIPISEENKNHLRQDLNNKFDKDLIDFSFLPVELQKKFCMEEEAKLNDLKE
INKEIFDKIEMLTSTNHIDQGINLEDFSLKAYKSKIFLLLDKVQARGNAPKGVQGSTKEI
EDTIIDENILKSFLTIDNIRLLFSY
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaacaatctttacatcttccactaccattacataaaaggcggagtttcaaccgttgtt
agaaatatcgtaaaatctctaaaagacgcatacaaaattactctctttggttcaaaaaaa
atggggatagatgggatagaagaggtcttatcttacgaaaatgttgattttattgatttc
ccagagctcggatacatttattatgacagcaccgattataaaacttttctcgaactcaaa
gaatcgataaaaaacaaattgaacaattatcacgatgagagggctatatactgggctcat
aactataatttaggcaaaaatcccgcatttacagaagcgtttaaagaatttatcacaaca
aaaaatatccccacaataattcaaattcacgactttcctgaatgtgcaagatgggaaaac
tattcttttataagaaaattcataaattcttcactgtatcctattaggaagaatatacag
tatgctactatcaatctatccgattacaacagacttataaaatgtggtataccttcagaa
aatgctttttatctcccaaatgctgttgaatttgctaaaaataaagataaaatagatgat
atcgacaaagatgaggtcataaataaactaaagaaattgggatataacgttgatcccaca
aataaaaacattttgtatccaacaagaacgataagaagaaaaaatatcttagaagcggtg
cttataaatcgcttatatggaaagagtaatctccttgtcacattaccagctaactctgat
aaagaaaggccatatgaaaaagttgtaaaagaaacctttgaatctgaaaaagttaaggga
gcttgggctatttcagcaaaagatccttcactttttccatacattctgaatatatctgat
ctgttcttttcttcttccgtattagaaggatttggaatgatatatttagaatcaaaattc
aacgaaaaaaactttttaacgagaaaattagatgtgatagaagatttcaaaaacataaaa
gaaataagttattacgatagatttttggttagtctttctcctaaagaaataaacaaagta
aaagaaaaatacgaagaacaaattaacaagatacctatttccgaagagaacaaaaatcat
ttaagacaagatttaaacaataaatttgataaagatttaattgatttttcatttctcccc
gtcgaacttcagaagaaattctgtatggaagaagaagcaaaacttaatgatttgaaagaa
attaacaaagaaatatttgataaaatagaaatgttgacttccacaaatcacattgatcaa
gggataaacttggaagatttctcattgaaggcgtataaaagtaaaatatttttattatta
gataaagtacaagctagaggaaacgccccgaagggggttcaaggaagtacaaaggaaata
gaagatacaataattgacgaaaatattctaaaatcctttctaacaatagataatataaga
ttactcttttcttattga

DBGET integrated database retrieval system