Passer montanus (Eurasian tree sparrow): 120498798 Help Entry 120498798         CDS       T07277                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism pmoa  Passer montanus (Eurasian tree sparrow) Pathway pmoa04060   Cytokine-cytokine receptor interaction pmoa04218   Cellular senescence pmoa04620   Toll-like receptor signaling pathway pmoa04621   NOD-like receptor signaling pathway pmoa04622   RIG-I-like receptor signaling pathway pmoa05132   Salmonella infection pmoa05164   Influenza A Brite KEGG Orthology (KO) [BR:pmoa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120498798  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     120498798  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120498798    04621 NOD-like receptor signaling pathway     120498798    04622 RIG-I-like receptor signaling pathway     120498798  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     120498798   09171 Infectious disease: bacterial    05132 Salmonella infection     120498798  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmoa04052]     120498798    00536 Glycosaminoglycan binding proteins [BR:pmoa00536]     120498798 Cytokines and neuropeptides [BR:pmoa04052]  Cytokines   Chemokines    120498798 Glycosaminoglycan binding proteins [BR:pmoa00536]  Heparan sulfate / Heparin   Chemokines    120498798 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Ig_J_chain bPH_6 Motif Other DBs NCBI-GeneID:  120498798 NCBI-ProteinID:  XP_039557873 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MNSKLVAVLALFLISAAVSQGRTLARMGTELRCQCIATHSRFIPPKSIQDVKLTQSGPHC KNVEVIATLKDGREVCLEPTAPWVQLIVKAILARAQQNSDSPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacagcaaactcgtagctgtcctggctcttttcctgatctcagcagctgtgtctcaa ggcaggactctggcaaggatgggaaccgagctgcggtgccagtgcatagccactcattcc aggttcattcccccgaaatccattcaagacgtgaagctgacacagagcggcccccactgc aagaacgttgaagtcatagctactctgaaggatggcagagaggtgtgcttggagcccact gctccttgggtacagctgattgtaaaggcaattttggccagggctcaacaaaattctgac tctcctctctaa

DBGET integrated database retrieval system