Passer montanus (Eurasian tree sparrow): 120506552 Help Entry 120506552         CDS       T07277                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pmoa  Passer montanus (Eurasian tree sparrow) Brite KEGG Orthology (KO) [BR:pmoa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pmoa03041]     120506552 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmoa04052]     120506552 (UBL5) Spliceosome [BR:pmoa03041]  Complex B   Other components    Complex B specific factors     120506552 (UBL5) Cytokines and neuropeptides [BR:pmoa04052]  Neuropeptides   Unclassified    120506552 (UBL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Motif Other DBs NCBI-GeneID:  120506552 NCBI-ProteinID:  XP_039574146 LinkDB All DBs Position Unknown AA seq 84 aa AA seqDB search MTPLPAPPSDVTPGSGAAVAERGGPGRYRSPEDSIRDLKKLIAAQTGTRWDKIVLKKWYT IFKDHVTLGDYEIHDGMNLELYYQ NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgacgccacttccggcgcctccctctgacgtcacccccggttccggcgcggctgtggcg gagcgaggcgggcccgggaggtaccggagccccgaggactcgatccgggacctgaagaag ctgatagcggcccagaccggcacgcgctgggacaagatcgtgctcaaaaaatggtacacg atcttcaaagaccacgtcacgcttggggactatgagatccacgacgggatgaacctggag ctctactaccagtag

DBGET integrated database retrieval system