Passer montanus (Eurasian tree sparrow): 120507987 Help Entry 120507987         CDS       T07277                                  Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism pmoa  Passer montanus (Eurasian tree sparrow) Brite KEGG Orthology (KO) [BR:pmoa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pmoa03019]     120507987    03029 Mitochondrial biogenesis [BR:pmoa03029]     120507987 Messenger RNA biogenesis [BR:pmoa03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      120507987 Mitochondrial biogenesis [BR:pmoa03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     120507987 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  120507987 NCBI-ProteinID:  XP_039577149 LinkDB All DBs Position Unknown AA seq 63 aa AA seqDB search MDSQDCPCATGGTCTCGDNCKCKNCKCTSCKKGCCSCCPAGCAKCAQGCVCKGPPSAKCS CCK NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggactctcaggattgcccttgtgccacaggtggcacctgcacctgcggggacaactgt aaatgcaaaaactgcaaatgcacatcgtgcaaaaaaggctgctgctcctgctgcccagct ggatgtgccaagtgtgcccagggctgcgtctgcaaggggcccccctccgccaagtgcagc tgctgcaaatag

DBGET integrated database retrieval system