Passer montanus (Eurasian tree sparrow): 120508545 Help Entry 120508545         CDS       T07277                                  Name (RefSeq) glutathione S-transferase-like   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism pmoa  Passer montanus (Eurasian tree sparrow) Pathway pmoa00480   Glutathione metabolism pmoa00980   Metabolism of xenobiotics by cytochrome P450 pmoa00982   Drug metabolism - cytochrome P450 pmoa00983   Drug metabolism - other enzymes pmoa01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:pmoa00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     120508545   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     120508545    00982 Drug metabolism - cytochrome P450     120508545    00983 Drug metabolism - other enzymes     120508545  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pmoa02000]     120508545 Enzymes [BR:pmoa01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      120508545 Transporters [BR:pmoa02000]  Other transporters   Pores ion channels [TC:1]    120508545 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 Motif Other DBs NCBI-GeneID:  120508545 NCBI-ProteinID:  XP_039578188 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MVEIDGMKLVQTRAIANYIATKYNLYGKDVKERALIDMYVEGMFDLNELLMAYGYQPADK KEQHFANMMDKAENRYFPAFEKVLKDHGKDFLVGNQLSRADVQLLEVILMAEEYKPSILA KFPLLQSFKARISNIPTIKKFLQPGSQRKPRTTEEDVAKAMKIFRS NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggtggagattgacgggatgaagctggtgcagaccagagccattgccaactacatagca accaagtacaacctctacgggaaggacgtgaaggagagagccctaatcgatatgtacgtg gaaggaatgttcgatctcaatgagttactaatggcatatggctaccaaccagcagacaaa aaagagcaacattttgcaaatatgatggacaaggctgaaaacagatacttcccagccttt gagaaggttttgaaagaccatggcaaagactttctggttggcaaccagctgagcagggca gatgttcaattacttgaagtcattttaatggcagaggagtacaaaccttctatacttgcc aaatttcctctcttgcagagcttcaaagcaagaataagcaatatccccacaattaagaaa ttcctgcagcctggcagccagaggaaaccacgaacaacagaggaagatgttgccaaagca atgaaaatattccgctcctga

DBGET integrated database retrieval system