Passer montanus (Eurasian tree sparrow): 120508844 Help Entry 120508844         CDS       T07277                                  Symbol B2M Name (RefSeq) beta-2-microglobulin   KO K08055   beta-2-microglobulin Organism pmoa  Passer montanus (Eurasian tree sparrow) Pathway pmoa05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pmoa00001]  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     120508844 (B2M)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmoa04147]     120508844 (B2M) Exosome [BR:pmoa04147]  Exosomal proteins   Exosomal proteins of breast milk    120508844 (B2M) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  C1-set Ig_3 Ig_2 Motif Other DBs NCBI-GeneID:  120508844 NCBI-ProteinID:  XP_039578749 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MARGALALGVLALLALLGLGAAAEAPKVEVYARSRAEEGKENTLHCFVTGFHPPKIDITL LKNGEPIPGVKYGDLSFNEKWQFQRLVYVPFVPTRGDSFSCRVMHSTMPEPRDYIWEPDF NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggcgcggggggccctggcgctcggtgtgcttgcgctgctggcgctgctcggcctgggg gcggccgctgaggcgccgaaggtcgaagtctacgcccgttcacgcgccgaggagggaaag gagaacaccctccactgctttgtcactggctttcacccgcccaagattgacatcacactc ctgaagaacggggagcccattcccggcgtcaagtacggggacttgtccttcaacgagaag tggcagttccagcgcctggtctatgtgcccttcgtccccacaaggggtgacagcttctct tgcagggtgatgcattccaccatgccggagccacgcgattacatctgggaaccagacttc tga

DBGET integrated database retrieval system