Passer montanus (Eurasian tree sparrow): 120511154 Help Entry 120511154         CDS       T07277                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism pmoa  Passer montanus (Eurasian tree sparrow) Pathway pmoa04382   Cornified envelope formation pmoa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmoa00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     120511154 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120511154 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmoa04147]     120511154 (S100A10) Exosome [BR:pmoa04147]  Exosomal proteins   Exosomal proteins of microglial cells    120511154 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EFhand_Ca_insen HalOD1 DUF2065 Motif Other DBs NCBI-GeneID:  120511154 NCBI-ProteinID:  XP_039583777 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQLEHAMETLMFTFHKYAGDKEHLAKEDLRALMDKEFPGFLENQRDPHALDRILRDVE QSRDGRVGFQGFFSLVAGLTIACNDYFVQHMKQRGRR NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtcgcagctggagcacgccatggagacgctgatgttcaccttccacaagtacgcg ggggacaaggagcacctggccaaggaggacctcagggcgctcatggacaaggagttcccg ggcttcctcgagaaccagcgggacccccacgccctggaccggatcctgcgggacgtggag cagagccgcgatggccgcgttggcttccagggcttcttctcgctggtggccgggctcacc atcgcctgcaacgactacttcgtgcagcacatgaagcagcgcggccgccgctga

DBGET integrated database retrieval system