Passer montanus (Eurasian tree sparrow): 120513648 Help Entry 120513648         CDS       T07277                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism pmoa  Passer montanus (Eurasian tree sparrow) Pathway pmoa04621   NOD-like receptor signaling pathway pmoa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmoa00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120513648 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120513648 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pmoa03110]     120513648 (TXN) Chaperones and folding catalysts [BR:pmoa03110]  Protein folding catalysts   Protein disulfide isomerase    120513648 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA Thioredoxin_7 DIM1 OST3_OST6 Glutaredoxin Thioredoxin_9 Redoxin Motif Other DBs NCBI-GeneID:  120513648 NCBI-ProteinID:  XP_039589191 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKTVGSLVEFEAELKSAGEKLLVVDFSATWCGPCKMIKPFFHSLCEKYGDVIFIEIDVD DAQDVASHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagaccgtgggcagcctggttgaatttgaggcagaactgaaatctgctggtgag aagcttttagtagttgatttctctgccacatggtgtggaccatgcaaaatgatcaagccc tttttccacagtttgtgtgagaagtatggtgatgtgatattcatagaaatcgatgtggat gatgcccaggatgttgcttcacactgtgatgtgaagtgcatgccaacgttccagttctac aagaatggaaagaaggtgcaggagttctctggggccaataaagagaagctggaagagacc attaaaagtctagtctaa

DBGET integrated database retrieval system