Passer montanus (Eurasian tree sparrow): 120514066 Help Entry 120514066         CDS       T07277                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism pmoa  Passer montanus (Eurasian tree sparrow) Pathway pmoa04137   Mitophagy - animal pmoa04140   Autophagy - animal pmoa04144   Endocytosis pmoa04145   Phagosome pmoa04148   Efferocytosis pmoa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmoa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120514066 (RAB7A)    04145 Phagosome     120514066 (RAB7A)    04140 Autophagy - animal     120514066 (RAB7A)    04137 Mitophagy - animal     120514066 (RAB7A)    04148 Efferocytosis     120514066 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120514066 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmoa04131]     120514066 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmoa04147]     120514066 (RAB7A)    04031 GTP-binding proteins [BR:pmoa04031]     120514066 (RAB7A) Membrane trafficking [BR:pmoa04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     120514066 (RAB7A) Exosome [BR:pmoa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120514066 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    120514066 (RAB7A)   Exosomal proteins of colorectal cancer cells    120514066 (RAB7A)   Exosomal proteins of bladder cancer cells    120514066 (RAB7A) GTP-binding proteins [BR:pmoa04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     120514066 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC FLYWCH_N ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  120514066 NCBI-ProteinID:  XP_039590117 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKTDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactctggggtgggg aagacatcgctcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggtgcagacttcctgacaaaagaggtgatggtggatgacaggctagtgacaatgcag atatgggatacagcaggccaagaacgatttcagtctctgggagttgccttctacagggga gcagattgctgtgtgctcgtatttgatgtcacggctcccaacaccttcaaaaccctagac agctggagggatgaattcctcattcaggccagtccaagggatcctgagaattttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gaactttacaatgaattccccgagcccatcaaactagacaagactgaccgagcgaaggct tctgcagagagctgcagctgctga

DBGET integrated database retrieval system