Passer montanus (Eurasian tree sparrow): 120514129 Help Entry 120514129         CDS       T07277                                  Symbol ARF4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism pmoa  Passer montanus (Eurasian tree sparrow) Pathway pmoa04144   Endocytosis Brite KEGG Orthology (KO) [BR:pmoa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120514129 (ARF4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmoa04131]     120514129 (ARF4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmoa04147]     120514129 (ARF4)    04031 GTP-binding proteins [BR:pmoa04031]     120514129 (ARF4) Membrane trafficking [BR:pmoa04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     120514129 (ARF4) Exosome [BR:pmoa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120514129 (ARF4)   Exosomal proteins of other body fluids (saliva and urine)    120514129 (ARF4)   Exosomal proteins of colorectal cancer cells    120514129 (ARF4) GTP-binding proteins [BR:pmoa04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     120514129 (ARF4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K GTP_EFTU FLAD1_M RXYLT1_N Csa3_N CRISPR_Cas2 AAA_18 Motif Other DBs NCBI-GeneID:  120514129 NCBI-ProteinID:  XP_039590225 LinkDB All DBs Position Unknown AA seq 180 aa AA seqDB search MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEAAEELQKMLQEDELRDAV LLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcaccatctcctcgcttttctcgcgcctcttcggcaagaagcagatgcgcatc cttatggttggtttggatgctgctggtaagacaaccattctttataaactgaaactagga gaaattgtcaccacaattcccactattggttttaatgtggagacggtagaatataaaaac atttgtttcacagtttgggatgttggtggtcaagataaaattagacctctttggaggcat tatttccaaaacacacagggcctcatttttgtggtagacagcaatgacagagagagaatc caggaagcagcagaagaactgcagaaaatgcttcaggaggatgagctgcgagatgcagtg ctgcttctgtttgcaaacaaacaggatctgccaaatgccatggcaatcagtgaaatgaca gataaactaggccttcagtctctgcgtaacagaacttggtatgtccaggctacctgtgct acacaaggaactggtctgtatgagggacttgactggctgtcaaatgaactctcaaaacgc taa

DBGET integrated database retrieval system