Pseudomonas monsensis: HV782_021195 Help Entry HV782_021195      CDS       T07539                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmoe  Pseudomonas monsensis Pathway pmoe01100   Metabolic pathways pmoe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmoe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HV782_021195 (acpP)    00074 Mycolic acid biosynthesis     HV782_021195 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HV782_021195 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 NirdL-like_HTH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QXH99059 UniProt:  A0AAX1P0D4 LinkDB All DBs Position complement(4814557..4814793) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVINSASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaactgggtgttaaagaa gaagaagtgatcaacagcgcttccttcgtagaagacctgggtgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gagaagatcactactgtacaagctgcaatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system