Pseudomonas mosselii: CLJ08_04875 Help Entry CLJ08_04875       CDS       T07806                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmol  Pseudomonas mosselii Pathway pmol01100   Metabolic pathways pmol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CLJ08_04875    00074 Mycolic acid biosynthesis     CLJ08_04875   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CLJ08_04875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ATB63978 LinkDB All DBs Position complement(993366..993602) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVKNNSSFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVNAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtcaaggaa gaagaagtgaagaacaactcttccttcgttgaagacctgggtgccgattcgcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaagatcactaccgttcaagctgccatcgactacgtcaacgcccaccaggcctaa

DBGET integrated database retrieval system