Pseudomonas mosselii: CLJ08_11670 Help Entry CLJ08_11670       CDS       T07806                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pmol  Pseudomonas mosselii Brite KEGG Orthology (KO) [BR:pmol00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmol03036]     CLJ08_11670 Chromosome and associated proteins [BR:pmol03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CLJ08_11670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Filament ADIP Asd-4 ZapB Motif Other DBs NCBI-ProteinID:  ATB65248 UniProt:  A0A135NVA3 LinkDB All DBs Position 2483782..2483991 Genome browser AA seq 69 aa AA seqDB search MQENDLQALMGRFELLIERVEQLKRQNALLVAQERTWREERAHLIEKNEIAKRKIESMIL RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcaagagaacgacctgcaagcactgatgggccggttcgagttgctgatcgaacgggtc gagcaactaaagcggcaaaatgcactcttagtagctcaggaacgaacctggcgcgaggag cgcgcccacctgatcgaaaagaacgagatcgccaaacgcaagatcgaatcgatgatcctg cgcctcaaggccctggagcaagactcatga

DBGET integrated database retrieval system