Pseudomonas monteilii SB3078: X969_00765
Help
Entry
X969_00765 CDS
T02972
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
pmon
Pseudomonas monteilii SB3078
Pathway
pmon03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
pmon00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
X969_00765
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
pmon03011
]
X969_00765
Ribosome [BR:
pmon03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
X969_00765
Bacteria
X969_00765
Archaea
X969_00765
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
TGS
Motif
Other DBs
NCBI-ProteinID:
AHC80554
LinkDB
All DBs
Position
159545..159895
Genome browser
AA seq
116 aa
AA seq
DB search
MTDKKVTRLRRARKARLKMHELEVVRLCVFRSSQHIYAQVISADGSKVLASASTLDKELR
DGATGNIDAATKVGKLVAERAKAAGVSQVAFDRSGFKYHGRVKALADAAREGGLEF
NT seq
351 nt
NT seq
+upstream
nt +downstream
nt
atgaccgacaaaaaagttactcgactgcgtcgcgctcgcaaagcacgtctcaagatgcac
gaactcgaagtcgtgcgcctgtgcgtgttccgctcctcgcagcacatctacgcccaggtc
atttcggccgacggcagcaaggttctggcaagcgcctcgaccttggacaaagaactgcgt
gatggcgccactggcaacatcgacgcggccactaaggttggcaagctggtagctgagcgt
gcgaaagccgccggtgtatctcaagttgcctttgaccgttccggcttcaagtaccatggc
cgcgtcaaagcgctggccgatgctgctcgtgaaggcgggctggagttctaa
DBGET
integrated database retrieval system