Pseudomonas monteilii SB3078: X969_24185 Help Entry X969_24185        CDS       T02972                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism pmon  Pseudomonas monteilii SB3078 Brite KEGG Orthology (KO) [BR:pmon00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pmon03110]     X969_24185 Chaperones and folding catalysts [BR:pmon03110]  Protein folding catalysts   Protein disulfide isomerase    X969_24185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 GST_N Glrx-like Thioredoxin_2 CLIC-like_N SH3BGR Motif Other DBs NCBI-ProteinID:  AHC84932 LinkDB All DBs Position complement(5163796..5164050) Genome browser AA seq 84 aa AA seqDB search MKPVIVYSSDYCPYCMRAKYLLESKGVAFEEIKVDGKPQVRAEMSQKAGRTSVPQIWIGS THVGGCDDLYALERAGKLDALLAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaagcccgtcatcgtctattccagcgactactgcccctactgcatgcgcgccaagtac ctgctcgagagcaagggcgtggccttcgaggaaatcaaggtcgacggcaagccacaggtt cgtgccgagatgagccagaaggccggccgtacatctgtgccgcagatctggatcggcagc acccacgtcggtggatgcgatgacctttatgccctggagcgcgccggcaagctcgacgcg ctgctggcggcctga

DBGET integrated database retrieval system