Penaeus monodon (black tiger shrimp): 119570122 Help Entry 119570122         CDS       T08784                                  Name (RefSeq) histone H3.2-like   KO K11253   histone H3 Organism pmoo  Penaeus monodon (black tiger shrimp) Brite KEGG Orthology (KO) [BR:pmoo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmoo03036]     119570122   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmoo04147]     119570122 Chromosome and associated proteins [BR:pmoo03036]  Eukaryotic type   Nucleosome assembly factors    Histones     119570122 Exosome [BR:pmoo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119570122 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  119570122 NCBI-ProteinID:  XP_037773920 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MARTKQTARKSTGGKAPAKQLANQAARSLPLLPEGSKSPSLQAWNRCPPPLLSWLCEASE AYLVGLFEDTNLCAIHAKDHNHPKDIPNCSPYPRRARLRA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcacgtaccaagcagactgcacgtaagtctaccggaggcaaggcccccgccaagcag ttggccaaccaggcagcacgtagtctgcccctgctaccggaggggtcaaaaagcccctcg ttacaggcctggaaccgttgccctcctcctctgctgtcatggctctgcgaagcttccgag gcttacctggtcggcctctttgaggacaccaacctgtgcgctatccacgccaaagatcac aatcatcctaaggacatcccaaattgctcgccgtatccgcggagagcgcgcctaagggcc taa

DBGET integrated database retrieval system