Pseudomonas moorei: PMm318_A21940
Help
Entry
PMm318_A21940 CDS
T11016
Symbol
lptG
Name
(GenBank) LPS export ABC transporter permease LptG
KO
K11720
lipopolysaccharide export system permease protein
Organism
pmor Pseudomonas moorei
Pathway
pmor02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
pmor00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
PMm318_A21940 (lptG)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
pmor02000
]
PMm318_A21940 (lptG)
Transporters [BR:
pmor02000
]
ABC transporters, prokaryotic type
ABC-2 type and other transporters
Lipopolysaccharide transporter
PMm318_A21940 (lptG)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LptF_LptG
Motif
Other DBs
NCBI-ProteinID:
BFT61435
LinkDB
All DBs
Position
2412117..2413178
Genome browser
AA seq
353 aa
AA seq
DB search
MVKLDRYIGSSVLIAILAVLGIILGLATLFAFIDEMGEISDTYTLSDVTSYVLLTAPRRL
YDMLPMAALIGCLIGLGSLASNSELTIMRAAGVSIGRIVWAVMKPMLVLMIAGVLIGEYV
APASENIAQANRSLAQGSGDAQSAKHGMWHRQGDEFIHINSVQPNGILYGVTRYRFDAER
HMLSASFAKRADFDKEHWQLTDVTTTLFHEKSSEVVNAPQERWDVALSPQLLNTVVMTPE
ALSISGLWGYIHYLAEQGLNNGRYWLAFWVKVLQPLVTAALVLMAISFIFGPLRSVTLGQ
RVFTGVLVGFTFRIAQDLLGPSSLVFGFSPLFAVLVPASICALAGLLLLRRAG
NT seq
1062 nt
NT seq
+upstream
nt +downstream
nt
gtggttaagctcgatcgctacatcggtagcagcgtgctcattgcgatcctggcggtactg
gggatcatcctgggcctggcaacgttgtttgcgttcatcgacgaaatgggcgagatcagc
gatacctacaccctgtccgatgtcaccagttatgtgctgctgaccgcaccgcgccgcctt
tacgacatgttgccgatggcggcgctgatcggttgcctgatcggcctcggcagcctggcc
agcaacagcgagttgaccatcatgcgcgccgccggcgtgtcgatcggacgaatcgtctgg
gcggtcatgaagcccatgctggtgctgatgattgccggtgtgctgattggcgagtatgtc
gcccccgccagcgaaaacatcgcacaggccaatcgttccctggcccagggcagtggtgac
gcgcaaagtgccaagcacggcatgtggcaccgtcagggcgatgagttcatccatatcaac
tccgttcagcccaacggcattctgtacggtgtgacccgttatcgctttgacgccgagcgg
cacatgttgtcggccagcttcgccaagcgcgcggacttcgacaaggagcactggcagttg
accgatgtcaccaccacgctgttccacgagaagagttctgaagtggtgaatgctccccag
gagcgctgggacgtggcattgagtcctcaattgctcaataccgtggtgatgacacctgag
gcgctgtcgatcagcggtctgtgggggtatatccactacctggcggagcagggcttgaac
aatggtcgttactggctggcattttgggtcaaggtgttgcagccgctggtcacggccgca
ctggtgctgatggcgatttccttcattttcggcccgttgcgctcggtgaccctcggtcag
cgggtatttaccggggttctggtgggcttcaccttccgcattgctcaggacctgctgggc
ccttcgagcctggtgttcggtttctcaccgttgtttgcagtgctggtaccagccagtatc
tgcgccctggccgggctgttgttgttgcgtcgcgccggttga
DBGET
integrated database retrieval system