Pseudomonas moorei: PMm318_A26980 Help Entry PMm318_A26980     CDS       T11016                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmor  Pseudomonas moorei Pathway pmor01100   Metabolic pathways pmor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PMm318_A26980 (acpP)    00074 Mycolic acid biosynthesis     PMm318_A26980 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PMm318_A26980 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  BFT61939 LinkDB All DBs Position 2941278..2941514 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaactgggcgttaaagaa gaagaagtggtcaacaccgcttccttcgttgaagacctgggtgctgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagct gagaagatcactactgtacaagctgcaatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system