KEGG   Pseudomonas moorei: PMm318_A56700
Entry
PMm318_A56700     CDS       T11016                                 
Name
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
pmor  Pseudomonas moorei
Pathway
pmor02020  Two-component system
pmor02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pmor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PMm318_A56700
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    PMm318_A56700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pmor02022]
    PMm318_A56700
   02035 Bacterial motility proteins [BR:pmor02035]
    PMm318_A56700
Enzymes [BR:pmor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PMm318_A56700
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     PMm318_A56700
Two-component system [BR:pmor02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   PMm318_A56700
Bacterial motility proteins [BR:pmor02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PMm318_A56700
SSDB
Motif
Pfam: CheB_methylest Response_reg
Other DBs
NCBI-ProteinID: BFT64911
LinkDB
Position
complement(6129668..6130798)
AA seq 376 aa
MAVKVLVVDDSGFFRRRVSEILSADSNIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPEKVKQ
LLCEKILSIARSNRRVSTYTAPPPVAASAPTPAPSSVGSFSGNVPARPAPAPIPARAPAH
APTSPAPKRKAYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLVQHMPAAFTKAFAERL
DKLCRISVKEAEDGDILRPGLALLAPGGKQMMIDGRGAVKILPGDERLNYKPCVDITFGS
AAKSYGDKVLAVVLTGMGADGREGARLLKQGGSSIWAQDEASCVIYGMPMAIVKAELADA
VYSLDDIGRHLVEACV
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcagtcaaagtcctggtggtggacgattcggggtttttccgccgccgcgtctcggaa
attctttcagcggattcgaatatccaggtcgtcggcacggcgaccaacggaaaagaggcg
attgatcaggctctggccctcaagcccgacgtgatcaccatggactacgagatgccgatg
atggacggcatcacggcggtgcggcacatcatgcagcgctgcccgaccccggtgttgatg
ttttcctcgctgacccacgaaggcgcccgggtcaccctggatgcgctggacgccggcgcg
gtggacttcctgccgaagaatttcgaagacatctcgcgcaaccccgagaaggtcaagcaa
ctgctgtgcgagaagattctcagtatcgcgcgcagtaaccgtcgtgtcagcacctacacg
gcaccgccaccggtagcggcctccgcgccgacaccagcgccttcgagcgttggcagtttc
agcggcaacgtgcccgcgcgtccggccccggctccgatcccggctcgtgcgccagcgcac
gcacccacgtcgcctgcgcccaaacgcaaagcctacaaactggtggccatcggcacctcc
accggtggcccggtggccttgcagcgggtcctgacccagctgccggccaacttcccggca
ccgatcgtgctggtccagcacatgcccgcggccttcaccaaagcgttcgccgagcgtctg
gacaagctctgccgcatcagtgtcaaggaagccgaggacggcgatattctgcgtccgggc
ctggcgctgctggcaccgggtggcaagcaaatgatgatcgatggccgtggcgcggtgaaa
atcctgccgggcgacgagcgtttgaactacaagccttgcgtggacatcacctttggttct
gcggccaagtcctacggtgacaaagttctggcggtcgtgttgaccggcatgggcgccgac
ggtcgcgaaggcgcgcgcctgctcaagcagggcggcagttcgatctgggcccaggacgaa
gccagctgcgtgatctatggcatgccgatggccatcgtcaaagccgaactcgccgacgcg
gtgtatagcctcgacgacattggccggcacctggtcgaggcgtgtgtctga

DBGET integrated database retrieval system