Pseudomonas soli: O165_010390 Help Entry O165_010390       CDS       T03276                                  Name (GenBank) peptidylprolyl isomerase   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism pmos  Pseudomonas soli Brite KEGG Orthology (KO) [BR:pmos00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pmos03110]     O165_010390 Enzymes [BR:pmos01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      O165_010390 Chaperones and folding catalysts [BR:pmos03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     O165_010390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase Rotamase_3 Mtf2_C Rotamase_2 HMG-CoA_red Motif Other DBs NCBI-ProteinID:  AIN58669 UniProt:  A0A1H8ZIP0 LinkDB All DBs Position 2187999..2188274 Genome browser AA seq 91 aa AA seqDB search MKAQARHILVKTADEAEKLKQRIANGEAFDVLAKKFSTCPSGKRGGDLGEIRPGQMVGAI DQVIFKKPLRVVHGPIKSKFGYHLVQTFYRD NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaagcccaagcccgccacatcctggtcaagaccgctgacgaagccgaaaagctcaag cagcgcatcgccaacggcgaggctttcgacgtgctggcgaagaaattttccacctgcccg tccggcaagcgcggcggcgacctgggtgaaatacgtccggggcagatggtcggcgccatc gaccaggtgatcttcaagaagcccctgcgggtggtacacggaccgatcaagagcaagttc ggctatcacctggtgcaaacgttctatcgcgactga

DBGET integrated database retrieval system