Pseudomonas monteilii SB3101: X970_03555 Help Entry X970_03555        CDS       T02973                                  Name (GenBank) prohead protease   KO K03116   sec-independent protein translocase protein TatA Organism pmot  Pseudomonas monteilii SB3101 Pathway pmot03060   Protein export pmot03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pmot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     X970_03555  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     X970_03555  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pmot02044]     X970_03555 Secretion system [BR:pmot02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    X970_03555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AHC86520 UniProt:  V9UY23 LinkDB All DBs Position complement(750718..750951) Genome browser AA seq 77 aa AA seqDB search MGGIGIWQLVIVLLIVFLLFGTKRLKGLGSDVGEAIQGFRKSMGGDTDATPPAHTQVQQQ CPLTGQGTQQPQADRQP NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgggtggcattggaatctggcaactggtgatcgtactgctgatcgtattcctgctgttt ggtaccaagcgcctcaagggcctgggtagcgatgtgggcgaggcgatccagggttttcgc aagtccatgggcggtgacaccgacgccactcccccagcgcatacgcaggtgcagcaacag tgcccgctgacaggtcagggtacgcagcaaccgcaagcggatcgtcagccctga

DBGET integrated database retrieval system