Pasteurella multocida 36950: Pmu_14160 Help Entry Pmu_14160         CDS       T01729                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmp  Pasteurella multocida 36950 Pathway pmp00998   Biosynthesis of various antibiotics pmp01100   Metabolic pathways pmp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pmu_14160 (acpP)    00074 Mycolic acid biosynthesis     Pmu_14160 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pmu_14160 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N TMEM210 Motif Other DBs NCBI-ProteinID:  AET16298 LinkDB All DBs Position complement(1522347..1522577) Genome browser AA seq 76 aa AA seqDB search MSIEERVKKIIVEQLGVKEDEVKPEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVQNNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcattgaagaacgcgtaaaaaaaatcatcgttgaacaattaggcgttaaagaagac gaagttaaacctgaagcgtctttcgttgaagatttaggtgcggattctttagatactgtt gaattagtcatggctttagaagaagagttcgatatcgaaattccagacgaagaagctgag aaaatcacgacagttcaatctgcgatcgattacgttcaaaacaatcaataa

DBGET integrated database retrieval system