Paenibacillus mucilaginosus 3016: PM3016_7134 Help Entry PM3016_7134       CDS       T01757                                  Name (GenBank) Hup2   KO K03530   DNA-binding protein HU-beta Organism pmq  Paenibacillus mucilaginosus 3016 Brite KEGG Orthology (KO) [BR:pmq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pmq03032]     PM3016_7134    03036 Chromosome and associated proteins [BR:pmq03036]     PM3016_7134    03400 DNA repair and recombination proteins [BR:pmq03400]     PM3016_7134 DNA replication proteins [BR:pmq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PM3016_7134 Chromosome and associated proteins [BR:pmq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PM3016_7134 DNA repair and recombination proteins [BR:pmq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PM3016_7134 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF4656 YidB HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AFC33711 UniProt:  H6NSG1 LinkDB All DBs Position complement(8357606..8357878) Genome browser AA seq 90 aa AA seqDB search MNKTDLINNIAEKSGLTKKDVESVLNSFLGEISDALSRDDKVQLIGFGTFETRTRSGRTG RNPQTGEEISIPESKVPAFKAGNKLKEAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagacttgatcaataacatcgcagaaaaaagcggcctgaccaaaaaggac gtggaatccgtactgaacagcttccttggtgaaatctctgacgctttgtcccgcgacgac aaagtccagttaatcggcttcggtactttcgaaacccgcacgcgctccggccgcaccggc cgcaacccgcaaacgggcgaagagatctccattccggaatccaaagttcctgcattcaaa gcaggcaacaagcttaaagaagcggtgaagtaa

DBGET integrated database retrieval system